A12354
SBF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12354
- Additional Names:
- CMT4B3|DENND7A|MTMR5|SBF1
- Application:
- ELISA, WB
- Molecular Weight:
- 208kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PPYDWELAQGPPEPPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAAR
- Uniprot:
- O95248
- Synonyms:
- CMT4B3;DENN/MADD domain containing 7A;DENND7A;inactive phosphatidylinositol 3-phosphatase 5;MTMR5;myotubularin-related protein 5;SET-binding factor 1
- Extra Details:
- This gene encodes a member of the protein-tyrosine phosphatase family. However, the encoded protein does not appear to be a catalytically active phosphatase because it lacks several amino acids in the catalytic pocket. This protein contains a Guanine nucleotide exchange factor (GEF) domain which is necessary for its role in growth and differentiation. Mutations in this gene have been associated with Charcot-Marie-Tooth disease 4B3. Pseudogenes of this gene have been defined on chromosomes 1 and 8.
- Shipping Conditions:
- Blue Ice