A12353
KMT2A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12353
- Additional Names:
- ALL-1|ALL1|CXXC7|GAS7|HRX|HTRX|HTRX1|KMT2A|MLL|MLL1|MLL1A|TRX1|WDSTS
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 190kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGL
- Uniprot:
- Q03164
- Synonyms:
- ALL-1;CXXC-type zinc finger protein 7;CXXC7;histone-lysine N-methyltransferase 2A;HRX;HTRX1;lysine (K)-specific methyltransferase 2A;lysine N-methyltransferase 2A;mixed lineage leukemia 1;MLL;MLL1;MLL1A;Myeloid/lymphoid or mixed-lineage leukemia;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);Myeloid/lymphoid or mixed-lineage leukemia protein 1;trithorax-like protein;TRX1;WDSTS;zinc finger protein HRX
- Extra Details:
- This gene encodes a transcriptional coactivator that plays an essential role in regulating gene expression during early development and hematopoiesis. The encoded protein contains multiple conserved functional domains. One of these domains, the SET domain, is responsible for its histone H3 lysine 4 (H3K4) methyltransferase activity which mediates chromatin modifications associated with epigenetic transcriptional activation. This protein is processed by the enzyme Taspase 1 into two fragments, MLL-C and MLL-N. These fragments reassociate and further assemble into different multiprotein complexes that regulate the transcription of specific target genes, including many of the HOX genes. Multiple chromosomal translocations involving this gene are the cause of certain acute lymphoid leukemias and acute myeloid leukemias. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice






_WB_01.jpg)
_WB_02.jpg)
