A12348
PGC1A Alpha Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12348
- Additional Names:
- LEM6|PGC-1(alpha)|PGC-1alpha|PGC-1v|PGC1|PGC1A|PGC1A Alpha|PPARGC1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 102 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- ABP:
- No Import Docs
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
- Uniprot:
- Q9UBK2
- Synonyms:
- L-PGC-1alpha;LEM6;Ligand effect modulator 6;ligand effect modulator-6;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a;peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT;peroxisome proliferator-activated receptor gamma coactivator 1-alpha;PGC-1-alpha;PGC-1(alpha);PGC-1alpha;PGC-1v;PGC1;PGC1A;PPAR gamma coactivator variant form;PPARgamma coactivator 1alpha;PPARGC-1-alpha;PPARGC1
- Extra Details:
- The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
- Shipping Conditions:
- Blue Ice