A12339
ENPEP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12339
- Additional Names:
- APA|CD249|ENPEP|gp160
- Application:
- ELISA, WB
- Molecular Weight:
- 109kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWF
- Uniprot:
- Q07075
- Synonyms:
- aminopeptidase A;AP-A;APA;CD249;differentiation antigen gp160;EAP;glutamyl aminopeptidase;gp160
- Extra Details:
- The ENPEP gene encodes glutamyl aminopeptidase, a type II integral membrane protein with an extracellular zinc-binding domain. This protein can upregulate blood pressure by cleaving the N-terminal aspartate from angiotensin II, and can regulate blood vessel formation and enhance tumorigenesis in some tissues. Along with ANPEP and DPP4, ENPEP was found to be a candidate co-receptor for the coronavirus SARS-CoV-2, which causes COVID-19.
- Shipping Conditions:
- Blue Ice