A12334
ACSS2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A12334
- Additional Names:
- ACAS2|ACECS|AceCS1|ACS|ACSA|ACSS2|dJ1161H23.1
- Application:
- ELISA, WB
- Molecular Weight:
- 79kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSN
- Uniprot:
- Q9NR19
- Synonyms:
- ACAS2;ACECS;AceCS1;acetate thiokinase;Acetate--CoA ligase;acetate-CoA ligase;Acetyl-CoA synthetase;acetyl-CoA synthetase 1;acetyl-Coenzyme A synthetase 2 (ADP forming);acetyl-coenzyme A synthetase, cytoplasmic;ACS;ACSA;acyl-activating enzyme;Acyl-CoA synthetase short-chain family member 2;cytoplasmic acetyl-coenzyme A synthetase;dJ1161H23.1;propionate--CoA ligase
- Extra Details:
- This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice