NTS Rabbit polyclonal antibody

Size

£152.00

SKU:: A12326
Additional Names:: NMN-125|NN|NT|NT/N|NTS|NTS1
Application:: ELISA, WB, IF
Molecular Weight:: 20 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYIL
Uniprot:: P30990
Synonyms:: neurotensin/neuromedin N;NMN-125;NN;NT;NT/N;NTS1;pro-neurotensin/neuromedin
Extra Details:: This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Neurotensin also exhibits antimicrobial activity against bacteria and fungi. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active.