A12294
MERTK Rabbit monoclonal antibody
Size
POA
- SKU:
- A12294
- Additional Names:
- c-Eyk|c-mer|MER|MERTK|RP38|Tyro12
- Application:
- ELISA, WB
- Molecular Weight:
- 150-200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTV
- Uniprot:
- Q12866
- Synonyms:
- c-Eyk;c-mer;c-mer proto-oncogene tyrosine kinase;MER;MER receptor tyrosine kinase;proto-oncogene c-Mer;receptor tyrosine kinase MerTK;RP38;STK kinase;Tyro12;tyrosine-protein kinase Mer
- Extra Details:
- This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
- Shipping Conditions:
- Blue Ice