AP2S1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12270
Additional Names:: AP17|AP2S1|CLAPS2|FBH3|FBHOk|HHC3
Application:: ELISA, WB
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Uniprot:: P53680
Synonyms:: adaptor protein complex AP-2 subunit sigma;adaptor related protein complex 2 sigma 1 subunit;Adaptor-related protein complex 2 subunit sigma;AP-2 complex subunit sigma;AP17;CLAPS2;clathrin assembly protein 2 sigma small chain;clathrin coat assembly protein AP17;clathrin coat-associated protein AP17;clathrin-associated/assembly/adaptor protein, small 2 (17kD);FBH3;FBHOk;HA2 17 kDa subunit;HHC3;plasma membrane adaptor AP-2 17 kDa protein;sigma-2;sigma2-adaptin
Extra Details:: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants.