A12250
PORCN Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12250
- Additional Names:
- DHOF|FODH|MG61|PORC|PORCN|PPN
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG
- Uniprot:
- Q9H237
- Synonyms:
- DHOF;FODH;MG61;PORC;porcupine homolog;PPN;probable protein-cysteine N-palmitoyltransferase porcupine;Protein MG61;protein-serine O-palmitoleoyltransferase porcupine
- Extra Details:
- This gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the porcupine family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Disruption of this gene is associated with focal dermal hypoplasia, and the encoded protein has been implicated in cancer. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
- Shipping Conditions:
- Blue Ice