A12208
DNAL4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12208
- Additional Names:
- DNAL4|MRMV3|PIG27
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
- Uniprot:
- O96015
- Synonyms:
- dynein axonemal light chain 4;dynein light chain, outer arm 4;dynein, axonemal, light polypeptide 4;MRMV3;PIG27;proliferation-inducing gene 27;proliferation-inducing protein 27
- Extra Details:
- This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella.
- Shipping Conditions:
- Blue Ice

