A12172
PPIH Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12172
- Additional Names:
- CYP-20|CYPH|PPIH|SnuCyp-20|USA-CYP
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
- Uniprot:
- O43447
- Synonyms:
- cyclophilin H;CYP-20;CYPH;peptidyl-prolyl cis-trans isomerase H;PPIase h;rotamase H;small nuclear ribonucleoprotein particle-specific cyclophilin H;SnuCyp-20;U-snRNP-associated cyclophilin SnuCyp-20;U-snRNP-associated cyclophilin SunCyp-20;USA-CYP;USA-CyP SnuCyp-20
- Extra Details:
- The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
- Shipping Conditions:
- Blue Ice