SNRPF Rabbit polyclonal antibody

Size

£152.00

SKU:: A12162
Additional Names:: Sm-F|SMF|snRNP-F|SNRPF
Application:: ELISA, WB, IHC-P
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Uniprot:: P62306
Synonyms:: sm protein F;Sm-F;small nuclear ribonucleoprotein F;SMF;snRNP-F
Extra Details:: Enables RNA binding activity. Involved in spliceosomal snRNP assembly. Located in cytosol and nucleus. Part of several cellular components, including methylosome; nucleus; and pICln-Sm protein complex. Biomarker of nasopharynx carcinoma.