EP400 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12151
Additional Names:: CAGH32|EP400|P400|TNRC12
Application:: ELISA, WB
Molecular Weight:: 400kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPG
Uniprot:: Q96L91
Synonyms:: CAG repeat protein 32;CAGH32;domino homolog;E1A-binding protein p400;hDomino;hDomino(p400);P400;p400 kDa SWI2/SNF2-related protein;p400 SWI2/SNF2-related protein;TNRC12;trinucleotide repeat containing 12;trinucleotide repeat-containing gene 12 protein
Extra Details:: Predicted to enable several functions, including ATP binding activity; ATP-dependent chromatin remodeler activity; and protein antigen binding activity. Involved in histone H2A acetylation and histone H4 acetylation. Part of NuA4 histone acetyltransferase complex and Swr1 complex.