A12150
DTL Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12150
- Additional Names:
- CDT2|DCAF2|DTL|L2DTL|RAMP
- Application:
- ELISA, WB
- Molecular Weight:
- 90kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKTLPSPVTITPSSMRKICTYFHRKSQEDFCGPEHSTEL
- Uniprot:
- Q9NZJ0
- Synonyms:
- CDT2;DCAF2;DDB1- and CUL4-associated factor 2;denticleless protein homolog;L2DTL;lethal(2) denticleless protein homolog;RA-regulated nuclear matrix-associated protein;RAMP;retinoic acid-regulated nuclear matrix-associated protein
- Extra Details:
- Contributes to ubiquitin-protein transferase activity. Involved in several processes, including protein ubiquitination; regulation of G2/M transition of mitotic cell cycle; and translesion synthesis. Located in centrosome; cytosol; and nuclear lumen. Part of Cul4A-RING E3 ubiquitin ligase complex and Cul4B-RING E3 ubiquitin ligase complex.
- Shipping Conditions:
- Blue Ice