COPZ1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12148
Additional Names:: CGI-120|COPZ|COPZ1|HSPC181|zeta-COP|zeta1-COP
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 19kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Uniprot:: P61923
Synonyms:: CGI-120;coatomer protein complex subunit zeta 1;coatomer protein complex, subunit zeta;coatomer subunit zeta-1;COPZ;HSPC181;zeta-1 COP;zeta-1-coat protein;zeta-COP;zeta1-COP
Extra Details:: This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants.