SLC25A24 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12138
Additional Names:: APC1|SCAMC-1|SCAMC1|SLC25A24
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
Uniprot:: Q6NUK1
Synonyms:: APC1;calcium-binding mitochondrial carrier protein SCaMC-1;calcium-binding transporter;mitochondrial ATP-Mg/Pi carrier protein 1;mitochondrial Ca(2+)-dependent solute carrier protein 1;SCAMC-1;SCAMC1;short calcium-binding mitochondrial carrier 1;small calcium-binding mitochondrial carrier protein 1;solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24;Solute carrier family 25 member 24
Extra Details:: This gene encodes a carrier protein that transports ATP-Mg exchanging it for phosphate. Multiple transcript variants encoding different isoforms have been found for this gene.