ACAP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12127
Additional Names:: ACAP2|CENTB2|CNT-B2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 115kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILT
Uniprot:: Q15057
Synonyms:: Arf GAP with coiled coil, ANK repeat and PH domains 2;arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2;centaurin-beta-2;CENTB2;CNT-B2
Extra Details:: Enables GTPase activator activity. Acts upstream of or within actin filament-based process. Located in ruffle.