A12124
SART3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12124
- Additional Names:
- DSAP1|P100|p110|p110(nrb)|RP11-13G14|SART3|TIP110
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK
- Uniprot:
- Q15020
- Synonyms:
- DSAP1;HIV-1 Tat-interacting protein of 110kDa;hSART-3;P100;p110;p110 nuclear RNA-binding protein;p110(nrb);PRP24 homolog;RP11-13G14;SART-3;squamous cell carcinoma antigen recognized by T cells 3;squamous cell carcinoma antigen recognized by T-cells 3;tat-interacting protein of 110 kDa;TIP110
- Extra Details:
- The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.
- Shipping Conditions:
- Blue Ice