NDUFA8 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12118
Additional Names:: CI-19KD|CI-PGIV|MC1DN37|NDUFA8|PGIV
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 19kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Uniprot:: P51970
Synonyms:: CI-19KD;CI-PGIV;complex I-19kD;complex I-PGIV;MC1DN37;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8;NADH-ubiquinone oxidoreductase 19 kDa subunit;NADH:ubiquinone oxidoreductase PGIV subunit;PGIV
Extra Details:: The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.