RanBP9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A12097
Additional Names:: BPM-L|BPM90|RanBP7|RanBP9|RANBPM
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQL
Uniprot:: Q96S59
Synonyms:: BPM-L;BPM90;novel centrosomal protein RanBPM;Ran Binding Protein in the Microtubule organizing center;ran binding protein, centrosomal;ran-binding protein 9;ran-binding protein M;RanBP7;RANBPM
Extra Details:: This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.