A12084
PKLR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12084
- Additional Names:
- PK1|PKL|PKLR|PKRL|RPK
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
- Uniprot:
- P30613
- Synonyms:
- PK1;PKL;PKRL;pyruvate kinase 1;pyruvate kinase isozyme R/L;pyruvate kinase isozymes L/R;pyruvate kinase isozymes R/L;pyruvate kinase PKLR;pyruvate kinase type L;pyruvate kinase, liver and blood cell;pyruvate kinase, liver and RBC;R-type/L-type pyruvate kinase;red cell/liver pyruvate kinase;RPK
- Extra Details:
- The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

