A12069
GIGYF2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12069
- Additional Names:
- GIGYF2|GYF2|PARK11|PERQ2|PERQ3|TNRC15
- Application:
- ELISA, WB
- Molecular Weight:
- 150-170kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTDRVGVASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPAKVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVS
- Uniprot:
- Q6Y7W6
- Synonyms:
- GRB10-interacting GYF protein 2;GYF2;PARK11;Parkinson disease (autosomal recessive, early onset) 11;PERQ amino acid rich, with GYF domain 3;PERQ amino acid-rich with GYF domain-containing protein 2;PERQ2;PERQ3;TNRC15;trinucleotide repeat-containing gene 15 protein
- Extra Details:
- This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

