A12060
OLR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12060
- Additional Names:
- CLEC8A|LOX1|LOXIN|OLR1|SCARE1|SLOX1
- Application:
- ELISA, WB
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESEN
- Uniprot:
- P78380
- Synonyms:
- C-type lectin domain family 8 member A;CLEC8A;hLOX-1;Lectin-like oxidized LDL receptor 1;lectin-type oxidized LDL receptor 1;LOX1;LOXIN;ox LDL receptor 1;oxidized low density lipoprotein (lectin-like) receptor 1;oxidized low-density lipoprotein receptor 1;oxidized low-density lipoprotein receptor 1, soluble form;SCARE1;scavenger receptor class E, member 1;SLOX1
- Extra Details:
- This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice