A12052
POLK Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12052
- Additional Names:
- DINB1|DINP|POLK|POLQ
- Application:
- ELISA, WB
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS
- Uniprot:
- Q9UBT6
- Synonyms:
- DINB protein;DINB1;DINP;DNA polymerase kappa;POLQ;polymerase (DNA directed) kappa
- Extra Details:
- This gene encodes a member of the DNA polymerase type-Y family of proteins. The encoded protein is a specialized DNA polymerase that catalyzes translesion DNA synthesis, which allows DNA replication in the presence of DNA lesions. Human cell lines lacking a functional copy of this gene exhibit impaired genome integrity and enhanced susceptibility to oxidative damage. Mutations in this gene that impair enzyme activity may be associated with prostate cancer in human patients.
- Shipping Conditions:
- Blue Ice