A12040
Septin 11 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A12040
- Additional Names:
- SEPT11|Septin 11
- Application:
- ELISA, WB
- Molecular Weight:
- 49kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEY
- Uniprot:
- Q9NVA2
- Synonyms:
- epididymis secretory sperm binding protein;SEPT11;septin-11
- Extra Details:
- SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking (Hanai et al., 2004 [PubMed 15196925]; Nagata et al., 2004 [PubMed 15485874]).
- Shipping Conditions:
- Blue Ice