POLR1B Rabbit polyclonal antibody

Size

£152.00

SKU:: A12034
Additional Names:: A135|POLR1B|RPA135|RPA2|Rpo1-2|TCS4
Application:: ELISA, WB
Molecular Weight:: 128kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQSPLVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFIDLSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMYYKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAE
Uniprot:: Q9H9Y6
Synonyms:: A135;DNA-directed RNA polymerase I 135 kDa polypeptide;DNA-directed RNA polymerase I 135kDa polypeptide;DNA-directed RNA polymerase I subunit RPA2;polymerase (RNA) I polypeptide B, 128kDa;polymerase (RNA) I subunit B;RNA polymerase I subunit 2;RPA135;RPA2;Rpo1-2;TCS4
Extra Details:: Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).