A12033
PIBF1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A12033
- Additional Names:
- C13orf24|CEP90|JBTS33|PIBF|PIBF1
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT
- Uniprot:
- Q8WXW3
- Synonyms:
- C13orf24;centrosomal protein of 90 kDa;CEP90;JBTS33;PIBF;progesterone-induced-blocking factor 1
- Extra Details:
- This gene encodes a protein that is induced by the steroid hormone progesterone and plays a role in the maintenance of pregnancy. The encoded protein regulates multiple facets of the immune system to promote normal pregnancy including cytokine synthesis, natural killer (NK) cell activity, and arachidonic acid metabolism. Low serum levels of this protein have been associated with spontaneous pre-term labor in humans. This protein may promote the proliferation, migration and invasion of glioma.
- Shipping Conditions:
- Blue Ice

