NeuroD1 Rabbit monoclonal antibody

Size

POA

SKU:: A12020
Additional Names:: BETA2|BHF-1|bHLHa3|MODY6|NEUROD|NeuroD1|T2D
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFK
Uniprot:: Q13562
Synonyms:: basic helix-loop-helix transcription factor;beta-cell E-box transactivator 2;BETA2;BHF-1;bHLHa3;class A basic helix-loop-helix protein 3;MODY6;NEUROD;neurogenic differentiation factor 1;neurogenic helix-loop-helix protein NEUROD;T2D
Extra Details:: This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus.