CAPN3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11995
Additional Names:: CANP3|CANPL3|CAPN3|LGMD2|LGMD2A|LGMDD4|LGMDR1|nCL-1|p94
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 114kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA
Uniprot:: P20807
Synonyms:: Calcium-activated neutral proteinase 3;Calpain L3;Calpain p94;calpain p94, large [catalytic] subunit;calpain-3;calpain, large polypeptide L3;CANP3;CANPL3;LGMD2;LGMD2A;LGMDD4;LGMDR1;Muscle-specific calcium-activated neutral protease 3;muscle-specific calcium-activated neutral protease 3 large subunit;nCL-1;new calpain 1;p94
Extra Details:: Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.

Shipping Conditions:: Blue Ice