A1199
CD86 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1199
- Additional Names:
- B7-2|B7.2|B70|CD28LG2|CD86|LAB72
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 60-85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL
- Uniprot:
- P42081
- Synonyms:
- Activation B7-2 antigen;B-lymphocyte activation antigen B7-2;B7-2;B7.2;B70;BU63;CD28LG2;CD86 antigen (CD28 antigen ligand 2, B7-2 antigen);CTLA-4 counter-receptor B7.2;FUN-1;LAB72;T-lymphocyte activation antigen CD86
- Extra Details:
- This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice



_IF_01.jpg)