A11986
TIMP3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11986
- Additional Names:
- HSMRK222|K222|K222TA2|SFD|TIMP3
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa/25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATD
- Uniprot:
- P35625
- Synonyms:
- HSMRK222;K222;K222TA2;metalloproteinase inhibitor 3;MIG-5 protein;protein MIG-5;SFD;TIMP-3;tissue inhibitor of metalloproteinases 3
- Extra Details:
- This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
- Shipping Conditions:
- Blue Ice