SLC5A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11976
Additional Names:: D22S675|NAGT|SGLT-1|SGLT1|SLC5A1
Application:: ELISA, WB
Molecular Weight:: 74kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA
Uniprot:: P13866
Synonyms:: D22S675;high affinity sodium-glucose cotransporter;Na+/glucose cotransporter 1;NAGT;SGLT1;sodium/glucose cotransporter 1;solute carrier family 5 (sodium/glucose cotransporter), member 1;Solute carrier family 5 member 1
Extra Details:: This gene encodes a member of the sodium-dependent glucose transporter (SGLT) family. The encoded integral membrane protein is the primary mediator of dietary glucose and galactose uptake from the intestinal lumen. Mutations in this gene have been associated with glucose-galactose malabsorption. Multiple transcript variants encoding different isoforms have been found for this gene.