A11948
SAA3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11948
- Additional Names:
- l7R3|Saa-3|SAA3
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
- Synonyms:
- AV098916;l7;l7R3;Sa;Saa-3;SAA3;serum amyloid A-3 protein
- Extra Details:
- Enables Toll-like receptor 4 binding activity and chemoattractant activity. Acts upstream of or within several processes, including I-kappaB phosphorylation; cellular response to interleukin-1; and response to stilbenoid. Located in extracellular space. Is expressed in cerebellum; ileum; liver; reproductive system; and thymus. Orthologous to several human genes including SAA2 (serum amyloid A2).
- Shipping Conditions:
- Blue Ice