HIF1A Alpha Rabbit polyclonal antibody

Size

£152.00

SKU:: A11945
Additional Names:: bHLHe78|HIF-1-alpha|HIF-1A|HIF-1alpha|HIF1|HIF1-ALPHA|HIF1A Alpha|MOP1|PASD8
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 120 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS
Uniprot:: Q16665
Synonyms:: ARNT interacting protein;ARNT-interacting protein;basic-helix-loop-helix-PAS protein MOP1;bHLHe78;class E basic helix-loop-helix protein 78;HIF-1-alpha;HIF-1A;HIF-1alpha;HIF1;HIF1-ALPHA;hypoxia inducible factor 1 alpha subunit;hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia-inducible factor 1-alpha;hypoxia-inducible factor1alpha;member of PAS protein 1;member of PAS superfamily 1;MOP1;PAS domain-containing protein 8;PAS domain-containing protein 8", "Class E basic helix-loop-helix protein 78", "Member of PAS protein 1;PASD8
Extra Details:: This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Shipping Conditions:: Blue Ice