A1187
IK KappaBA Alpha Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1187
- Additional Names:
- EDAID2|IKBA|IK KappaBA Alpha|MAD-3|NFKBI
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRI
- Uniprot:
- P25963
- Synonyms:
- EDAID2;I-kappa-B-alpha;IkappaBalpha;ikB-alpha;IKBA;MAD-3;major histocompatibility complex enhancer-binding protein MAD3;NF-kappa-B inhibitor alpha;NFKBI;nuclear factor of kappa light chain gene enhancer in B-cells;nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha
- Extra Details:
- This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.
- Shipping Conditions:
- Blue Ice