A11831
HTR2C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11831
- Additional Names:
- 5-HT1C|5-HT2C|5-HTR2C|5HTR2C|HTR1C|HTR2C
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSF
- Uniprot:
- P28335
- Synonyms:
- 5-HT1C;5-HT2C;5-HTR2C;5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled;5-hydroxytryptamine receptor 1C;5-hydroxytryptamine receptor 2C;5HTR2C;HTR1C;serotonin 5-HT-1C receptor;serotonin 5-HT-2C receptor;Serotonin receptor 2C
- Extra Details:
- This gene encodes a seven-transmembrane G-protein-coupled receptor. The encoded protein responds to signaling through the neurotransmitter serotonin. The mRNA of this gene is subject to multiple RNA editing events, where adenosine residues encoded by the genome are converted to inosines. RNA editing is predicted to alter the structure of the second intracellular loop, thereby generating alternate protein forms with decreased ability to interact with G proteins. Abnormalities in RNA editing of this gene have been detected in victims of suicide that suffer from depression. In addition, naturally-occuring variation in the promoter and 5' non-coding and coding regions of this gene may show statistically-significant association with mental illness and behavioral disorders. Alternative splicing results in multiple different transcript variants.
- Shipping Conditions:
- Blue Ice