A1176
KCNE1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1176
- Additional Names:
- ISK|JLNS|JLNS2|KCNE1|LQT2/5|LQT5|MinK
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL
- Uniprot:
- P15382
- Synonyms:
- cardiac delayed rectifier potassium channel protein;delayed rectifier potassium channel subunit IsK;IKs producing slow voltage-gated potassium channel subunit beta Mink;ISK;JLNS;JLNS2;Long QT syndrome 5;LQT2/5;LQT5;minimal potassium channel;MinK;potassium channel, voltage gated subfamily E regulatory beta subunit 1;potassium voltage-gated channel subfamily E member 1;potassium voltage-gated channel, Isk-related family, member 1;potassium voltage-gated channel, Isk-related subfamily, member 1;voltage gated potassiun channel accessory subunit
- Extra Details:
- The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
- Shipping Conditions:
- Blue Ice

