STUB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11751
Additional Names:: CHIP|HSPABP2|NY-CO-7|SCA48|SCAR16|SDCCAG7|STUB1|UBOX1
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Uniprot:: Q9UNE7
Synonyms:: antigen NY-CO-7;carboxy terminus of Hsp70-interacting protein;CHIP;CLL-associated antigen KW-8;E3 ubiquitin-protein ligase CHIP;heat shock protein A binding protein 2 (c-terminal);HSPABP2;NY-CO-7;RING-type E3 ubiquitin transferase CHIP;SCA48;SCAR16;SDCCAG7;serologically defined colon cancer antigen 7;STIP1 homology and U box-containing protein 1;STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase;UBOX1
Extra Details:: This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2.

Shipping Conditions:: Blue Ice