NACC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11720
Additional Names:: BEND8|BTBD14B|BTBD30|NAC-1|NAC1|NACC1|NECFM
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL
Uniprot:: Q96RE7
Synonyms:: BEN domain containing 8;BEND8;BTB/POZ domain-containing protein 14B;BTBD14B;BTBD30;NAC-1;NAC1;NECFM;nucleus accumbens associated 1, BEN and BTB (POZ) domain containing;nucleus accumbens-associated protein 1;transcriptional repressor NAC1
Extra Details:: This gene encodes a member of the BTB/POZ protein family. BTB/POZ proteins are involved in several cellular processes including proliferation, apoptosis and transcription regulation. The encoded protein is a transcriptional repressor that plays a role in stem cell self-renewal and pluripotency maintenance. The encoded protein also suppresses transcription of the candidate tumor suppressor Gadd45GIP1, and expression of this gene may play a role in the progression of multiple types of cancer. A pseudogene of this gene is located on the short arm of chromosome 9.

Shipping Conditions:: Blue Ice