A11718
HES1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11718
- Additional Names:
- bHLHb39|HES-1|HES1|HHL|HRY
- Application:
- ELISA, WB
- Molecular Weight:
- 29kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQA
- Uniprot:
- Q14469
- Synonyms:
- bHLHb39;class B basic helix-loop-helix protein 39;Hairy and enhancer of split 1;hairy homolog;hairy-like protein;HES-1;HHL;HRY;transcription factor HES-1
- Extra Details:
- This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
- Shipping Conditions:
- Blue Ice