HSP47/SERPINH1 Rabbit monoclonal antibody

Size

POA

SKU:: A11698
Additional Names:: AsTP3|CBP1|CBP2|gp46|HSP47|HSP47/SERPINH1|OI10|PIG14|PPROM|RA-A47|SERPINH2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 46kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Uniprot:: P50454
Synonyms:: 47 kDa heat shock protein;arsenic-transactivated protein 3;AsTP3;CBP1;CBP2;cell proliferation-inducing gene 14 protein;collagen binding protein 1;Collagen-binding protein;colligin-1;colligin-2;gp46;HSP47;OI10;PIG14;PPROM;RA-A47;rheumatoid arthritis antigen A-47;rheumatoid arthritis-related antigen RA-A47;serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1);serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2);serpin H1;serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1);SERPINH2
Extra Details:: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.

Shipping Conditions:: Blue Ice