A11683
Na+/K+-ATPase Rabbit monoclonal antibody
Size
POA
- SKU:
- A11683
- Additional Names:
- CMT2DD|HOMGSMR2|Na+/K+-ATPase
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 100 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
- Uniprot:
- P05023
- Synonyms:
- ATPase, Na+/K+ transporting, alpha 1 polypeptide;CMT2DD;HOMGSMR2;Na, K-ATPase, alpha-A catalytic polypeptide;Na,K-ATPase alpha-1 subunit;Na,K-ATPase catalytic subunit alpha-A protein;Na(+)/K(+) ATPase alpha-1 subunit;Na+/K+ ATPase 1;sodium pump subunit alpha-1;sodium-potassium ATPase catalytic subunit alpha-1;sodium-potassium-ATPase, alpha 1 polypeptide;sodium/potassium-transporting ATPase subunit alpha-1
- Extra Details:
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice