SLC12A2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11675
Additional Names:: BSC|BSC-2|BSC2|CCC1|KILQS|NKCC1|PPP1R141|SLC12A2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 160-200kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
Uniprot:: P55011
Synonyms:: basolateral Na-K-Cl symporter;BSC;BSC2;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;KILQS;NKCC1;PPP1R141;protein phosphatase 1, regulatory subunit 141;solute carrier family 12 (sodium/potassium/chloride transporter), member 2;solute carrier family 12 (sodium/potassium/chloride transporters), member 2;solute carrier family 12 member 2
Extra Details:: The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.