OLA1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11671
Additional Names:: DOC45|GBP45|GTBP9|GTPBP9|OLA1|PTD004
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT
Uniprot:: Q9NTK5
Synonyms:: DNA damage-regulated overexpressed in cancer 45;DNA damage-regulated overexpressed in cancer 45 protein;DOC45;GBP45;GTBP9;GTP-binding protein 9;GTP-binding protein 9 (putative);GTP-binding protein PTD004;GTPBP9;homologous yeast-44.2 protein;obg-like ATPase 1;PTD004
Extra Details:: This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22.