A11663
SPRTN Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A11663
- Additional Names:
- C1orf124|DVC1|PRO4323|spartan|SPRTN
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKG
- Uniprot:
- Q9H040
- Synonyms:
- C1orf124;DNA damage protein targeting VCP;DNA damage-targeting VCP (p97) adaptor;DNA-dependent metalloprotease SPRTN;DVC1;PRO4323;Protein with SprT-like domain at the N terminus;spartan;zinc finger RAD18 domain-containing protein
- Extra Details:
- The protein encoded by this gene may play a role in DNA repair during replication of damaged DNA. This protein recruits valosin containing protein (p97) to stalled DNA replication forks where it may prevent excessive translesional DNA synthesis and limit the number of DNA-damage induced mutations. It may also be involved in replication-related G2/M-checkpoint regulation. Deficiency of a similar protein in mouse causes chromosomal instability and progeroid phenotypes. Mutations in this gene have been associated with Ruijs-Aalfs syndrome (RJALS). Alternatively spliced transcript variants have been identified.
- Shipping Conditions:
- Blue Ice

