A11609
MC3R Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A11609
- Additional Names:
- BMIQ9|MC3|MC3-R|MC3R|OB20|OQTL
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
- Uniprot:
- P41968
- Synonyms:
- BMIQ9;MC3;MC3-R;melanocortin receptor 3;OB20;obesity quantitative trait locus;OQTL
- Extra Details:
- This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
- Shipping Conditions:
- Blue Ice

