A11608
MAT2B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11608
- Additional Names:
- MAT-II|MAT2B|MATIIbeta|Nbla02999|SDR23E1|TGR
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
- Uniprot:
- Q9NZL9
- Synonyms:
- beta regulatory subunit of methionine adenosyltransferase;dTDP-4-keto-6-deoxy-D-glucose 4-reductase;MAT II beta;MAT-II;MATIIbeta;methionine adenosyltransferase 2 subunit beta;Methionine adenosyltransferase II beta;methionine adenosyltransferase II, beta;Nbla02999;putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase;putative protein product of Nbla02999;SDR23E1;short chain dehydrogenase/reductase family 23E, member 1;testicular tissue protein Li 118;TGR
- Extra Details:
- The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice