DIAPH1 Rabbit monoclonal antibody

Size

POA

SKU:: A11596
Additional Names:: DFNA1|DIA1|DIAPH1|DRF1|hDIA1|LFHL1|mDia1|SCBMS
Application:: ELISA, WB
Molecular Weight:: 160 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQML
Uniprot:: O60610
Synonyms:: DFNA1;DIA1;Diaphanous-related formin-1;DRF1;hDIA1;LFHL1;protein diaphanous homolog 1;SCBMS
Extra Details:: This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.