[KO Validated] RhoGDI Rabbit monoclonal antibody

Size

POA

SKU:: A11556
Additional Names:: DI|GDIA1|HEL-S-47e|NPHS8|RHOGDI|RHOGDI-1
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
Uniprot:: P52565
Synonyms:: epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor, aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;Rho-GDI alpha;RHOGDI;RHOGDI-1
Extra Details:: This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.