A1155
TRIF / TICAM1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1155
- Additional Names:
- IIAE6|MyD88-3|PRVTIRB|TICAM-1|TRIF|TRIF / TICAM1
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAP
- Uniprot:
- Q8IUC6
- Synonyms:
- IIAE6;MyD88-3;proline-rich, vinculin and TIR domain-containing protein B;PRVTIRB;putative NF-kappa-B-activating protein 502H;TICAM-1;TIR domain containing adaptor inducing interferon-beta;TIR domain-containing adapter molecule 1;TIR domain-containing adapter protein inducing IFN-beta;toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta;TRIF
- Extra Details:
- This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response. Mutations in this gene are associated with encephalopathy, acute, infection-induced.
- Shipping Conditions:
- Blue Ice